Universitas Siber Asia

  • 2022-01-06Tarikh pengumpulan
  • 2022-05-22Dikemas kini
Universitas Siber Asia
  • Alamat laman sesawang:www.unsia.ac.id
  • IP pelayan:185.237.145.9
  • Penerangan laman web:Universitas Siber Asia

nama domain:www.unsia.ac.idPenilaian

tentang 5000~500000

nama domain:www.unsia.ac.idaliran

264

nama domain:www.unsia.ac.idBaik atau buruk

Perniagaan tidak khusus. Sembilan belas gagal Nasib baik membawa nasib malang

laman web:Universitas Siber AsiaBerat

1

laman web:Universitas Siber AsiaIP

185.237.145.9

laman web:Universitas Siber Asiakandungan

UniversitasSiberAsia|KuliahFullOnlinePertamadiIndonesia /**/ img.wp-smiley,img.emoji{ display:inline!important; border:none!important; box-shadow:none!important; height:1em!important; width:1em!important; margin:00.07em!important; vertical-align:-0.1em!important; background:none!important; padding:0!important; }.has-text-align-justify{text-align:justify;}.wp-block-audiofigcaption{color:#555;font-size:13px;text-align:center}.is-dark-theme.wp-block-audiofigcaption{color:hsla(0,0%,100%,.65)}.wp-block-audio{margin:001em}.wp-block-code{border:1pxsolid#ccc;border-radius:4px;font-family:Menlo,Consolas,monaco,monospace;padding:.8em1em}.wp-block-embedfigcaption{color:#555;font-size:13px;text-align:center}.is-dark-theme.wp-block-embedfigcaption{color:hsla(0,0%,100%,.65)}.wp-block-embed{margin:001em}.blocks-gallery-caption{color:#555;font-size:13px;text-align:center}.is-dark-theme.blocks-gallery-caption{color:hsla(0,0%,100%,.65)}.wp-block-imefigcaption{color:#555;font-size:13px;text-align:center}.is-dark-theme.wp-block-imefigcaption{color:hsla(0,0%,100%,.65)}.wp-block-ime{margin:001em}.wp-block-pullquote{border-bottom:4pxsolid;border-top:4pxsolid;color:currentColor;margin-bottom:1.75em}.wp-block-pullquotecite,.wp-block-pullquotefooter,.wp-block-pullquote__citation{color:currentColor;font-size:.8125em;font-style:normal;text-transform:uppercase}.wp-block-quote{border-left:.25emsolid;margin:001.75em;padding-left:1em}.wp-block-quotecite,.wp-block-quotefooter{color:currentColor;font-size:.8125em;font-style:normal;position:relative}.wp-block-quote.has-text-align-right{border-left:none;border-right:.25emsolid;padding-left:0;padding-right:1em}.wp-block-quote.has-text-align-center{border:none;padding-left:0}.wp-block-quote.is-large,.wp-block-quote.is-style-large,.wp-block-quote.is-style-plain{border:none}.wp-block-search.wp-block-search__label{font-weight:700}.wp-block-search__button{border:1pxsolid#ccc;padding:.375em.625em}:where(.wp-block-group.has-background){padding:1.25em2.375em}.wp-block-separator.has-css-opacity{opacity:.4}.wp-block-separator{border:none;border-bottom:2pxsolid;margin-left:auto;margin-right:auto}.wp-block-separator.has-alpha-channel-opacity{opacity:1}.wp-block-separator:not(.is-style-wide):not(.is-style-dots){width:100px}.wp-block-separator.has-background:not(.is-style-dots){border-bottom:none;height:1px}.wp-block-separator.has-background:not(.is-style-wide):not(.is-style-dots){height:2px}.wp-block-table{margin:001em}.wp-block-tabletd,.wp-block-tableth{word-break:normal}.wp-block-tablefigcaption{color:#555;font-size:13px;text-align:center}.is-dark-theme.wp-block-tablefigcaption{color:hsla(0,0%,100%,.65)}.wp-block-videofigcaption{color:#555;font-size:13px;text-align:center}.is-dark-theme.wp-block-videofigcaption{color:hsla(0,0%,100%,.65)}.wp-block-video{margin:001em}.wp-block-template-part.has-background{margin-bottom:0;margin-top:0;padding:1.25em2.375em}/*!Thisfileisauto-generated*/.wp-block-button__link{color:#fff;background-color:#c;border-radius:9999px;box-shadow:none;text-decoration:none;padding:calc(.667em+2px)calc(1.333em+2px);font-size:1.125em}.wp-block-file__button{background:#c;color:#fff;text-decoration:none}body{--wp--preset--color--black:#;--wp--preset--color--cyan-bluish-gray:#abb8c3;--wp--preset--color--white:#ffffff;--wp--preset--color--pale-pink:#f78da7;--wp--preset--color--vivid-red:#cf2e2e;--wp--preset--color--luminous-vivid-orange:#ff6900;--wp--preset--color--luminous-vivid-amber:#fcb900;--wp--preset--color--light-green-cyan:#7bdcb5;--wp--preset--color--vivid-green-cyan:#00d084;--wp--preset--color--pale-cyan-blue:#8ed1fc;--wp--preset--color--vivid-cyan-blue:#0693e3;--wp--preset--color--vivid-purple:#9b51e0;--wp--preset--gradient--vivid-cyan-blue-to-vivid-purple:linear-gradient(135deg,rgba(6,147,227,1)0%,rgb(155,81,224)100%);--wp--preset--gradient--light-green-cyan-to-vivid-green-cyan:linear-gradient(135deg,rgb(122,220,180)0%,rgb(0,208,130)100%);--wp--preset--gradient--luminous-vivid-amber-to-luminous-vivid-orange:linear-gradient(135deg,rgba(252,185,0,1)0%,rgba(255,105,0,1)100%);--wp--preset--gradient--luminous-vivid-orange-to-vivid-red:linear-gradient(135deg,rgba(255,105,0,1)0%,rgb(207,46,46)100%);--wp--preset--gradient--very-light-gray-to-cyan-bluish-gray:linear-gradient(135deg,rgb(238,238,238)0%,rgb(169,184,195)100%);--wp--preset--gradient--cool-to-warm-spectrum:linear-gradient(135deg,rgb(74,234,220)0%,rgb(151,120,209)20%,rgb(207,42,186)40%,rgb(238,44,130)60%,rgb(251,105,98)80%,rgb(254,248,76)100%);--wp--preset--gradient--blush-light-purple:linear-gradient(135deg,rgb(255,206,236)0%,rgb(152,150,240)100%);--wp--preset--gradient--blush-bordeaux:linear-gradient(135deg,rgb(254,205,165)0%,rgb(254,45,45)50%,rgb(107,0,62)100%);--wp--preset--gradient--luminous-dusk:linear-gradient(135deg,rgb(255,203,112)0%,rgb(199,81,192)50%,rgb(65,88,208)100%);--wp--preset--gradient--pale-ocean:linear-gradient(135deg,rgb(255,245,203)0%,rgb(182,227,212)50%,rgb(51,167,181)100%);--wp--preset--gradient--electric-grass:linear-gradient(135deg,rgb(202,248,128)0%,rgb(113,206,126)100%);--wp--preset--gradient--midnight:linear-gradient(135deg,rgb(2,3,129)0%,rgb(40,116,252)100%);--wp--preset--font-size--small:13px;--wp--preset--font-size--medium:20px;--wp--preset--font-size--large:36px;--wp--preset--font-size--x-large:42px;--wp--preset--spacing--20:0.44rem;--wp--preset--spacing--30:0.67rem;--wp--preset--spacing--40:1rem;--wp--preset--spacing--50:1.5rem;--wp--preset--spacing--60:2.25rem;--wp--preset--spacing--70:3.38rem;--wp--preset--spacing--80:5.06rem;--wp--preset--shadow--natural:6px6px9pxrgba(0,0,0,0.2);--wp--preset--shadow--deep:12px12px50pxrgba(0,0,0,0.4);--wp--preset--shadow--sharp:6px6px0pxrgba(0,0,0,0.2);--wp--preset--shadow--outlined:6px6px0px-3pxrgba(255,255,255,1),6px6pxrgba(0,0,0,1);--wp--preset--shadow--crisp:6px6px0pxrgba(0,0,0,1);}:where(.is-layout-flex){gap:0.5em;}:where(.is-layout-grid){gap:0.5em;}body.is-layout-flow>.alignleft{float:left;margin-inline-start:0;margin-inline-end:2em;}body.is-layout-flow>.alignright{float:right;margin-inline-start:2em;margin-inline-end:0;}body.is-layout-flow>.aligncenter{margin-left:auto!important;margin-right:auto!important;}body.is-layout-constrained>.alignleft{float:left;margin-inline-start:0;margin-inline-end:2em;}body.is-layout-constrained>.alignright{float:right;margin-inline-start:2em;margin-inline-end:0;}body.is-layout-constrained>.aligncenter{margin-left:auto!important;margin-right:auto!important;}body.is-layout-constrained>:where(:not(.alignleft):not(.alignright):not(.alignfull)){max-width:var(--wp--style--global--content-size);margin-left:auto!important;margin-right:auto!important;}body.is-layout-constrained>.alignwide{max-width:var(--wp--style--global--wide-size);}body.is-layout-flex{display:flex;}body.is-layout-flex{flex-wrap:wrap;align-items:center;}body.is-layout-flex>*{margin:0;}body.is-layout-grid{display:grid;}body.is-layout-grid>*{margin:0;}:where(.wp-block-columns.is-layout-flex){gap:2em;}:where(.wp-block-columns.is-layout-grid){gap:2em;}:where(.wp-block-post-template.is-layout-flex){gap:1.25em;}:where(.wp-block-post-template.is-layout-grid){gap:1.25em;}.has-black-color{color:var(--wp--preset--color--black)!important;}.has-cyan-bluish-gray-color{color:var(--wp--preset--color--cyan-bluish-gray)!important;}.has-white-color{color:var(--wp--preset--color--white)!important;}.has-pale-pink-color{color:var(--wp--preset--color--pale-pink)!important;}.has-vivid-red-color{color:var(--wp--preset--color--vivid-red)!important;}.has-luminous-vivid-orange-color{color:var(--wp--preset--color--luminous-vivid-orange)!important;}.has-luminous-vivid-amber-color{color:var(--wp--preset--color--luminous-vivid-amber)!important;}.has-light-green-cyan-color{color:var(--wp--preset--color--light-green-cyan)!important;}.has-vivid-green-cyan-color{color:var(--wp--preset--color--vivid-green-cyan)!important;}.has-pale-cyan-blue-color{color:var(--wp--preset--color--pale-cyan-blue)!important;}.has-vivid-cyan-blue-color{color:var(--wp--preset--color--vivid-cyan-blue)!important;}.has-vivid-purple-color{color:var(--wp--preset--color--vivid-purple)!important;}.has-black-background-color{background-color:var(--wp--preset--color--black)!important;}.has-cyan-bluish-gray-background-color{background-color:var(--wp--preset--color--cyan-bluish-gray)!important;}.has-white-background-color{background-color:var(--wp--preset--color--white)!important;}.has-pale-pink-background-color{background-color:var(--wp--preset--color--pale-pink)!important;}.has-vivid-red-background-color{background-color:var(--wp--preset--color--vivid-red)!important;}.has-luminous-vivid-orange-background-color{background-color:var(--wp--preset--color--luminous-vivid-orange)!important;}.has-luminous-vivid-amber-background-color{background-color:var(--wp--preset--color--luminous-vivid-amber)!important;}.has-light-green-cyan-background-color{background-color:var(--wp--preset--color--light-green-cyan)!important;}.has-vivid-green-cyan-background-color{background-color:var(--wp--preset--color--vivid-green-cyan)!important;}.has-pale-cyan-blue-background-color{background-color:var(--wp--preset--color--pale-cyan-blue)!important;}.has-vivid-cyan-blue-background-color{background-color:var(--wp--preset--color--vivid-cyan-blue)!important;}.has-vivid-purple-background-color{background-color:var(--wp--preset--color--vivid-purple)!important;}.has-black-border-color{border-color:var(--wp--preset--color--black)!important;}.has-cyan-bluish-gray-border-color{border-color:var(--wp--preset--color--cyan-bluish-gray)!important;}.has-white-border-color{border-color:var(--wp--preset--color--white)!important;}.has-pale-pink-border-color{border-color:var(--wp--preset--color--pale-pink)!important;}.has-vivid-red-border-color{border-color:var(--wp--preset--color--vivid-red)!important;}.has-luminous-vivid-orange-border-color{border-color:var(--wp--preset--color--luminous-vivid-orange)!important;}.has-luminous-vivid-amber-border-color{border-color:var(--wp--preset--color--luminous-vivid-amber)!important;}.has-light-green-cyan-border-color{border-color:var(--wp--preset--color--light-green-cyan)!important;}.has-vivid-green-cyan-border-color{border-color:var(--wp--preset--color--vivid-green-cyan)!important;}.has-pale-cyan-blue-border-color{border-color:var(--wp--preset--color--pale-cyan-blue)!important;}.has-vivid-cyan-blue-border-color{border-color:var(--wp--preset--color--vivid-cyan-blue)!important;}.has-vivid-purple-border-color{border-color:var(--wp--preset--color--vivid-purple)!important;}.has-vivid-cyan-blue-to-vivid-purple-gradient-background{background:var(--wp--preset--gradient--vivid-cyan-blue-to-vivid-purple)!important;}.has-light-green-cyan-to-vivid-green-cyan-gradient-background{background:var(--wp--preset--gradient--light-green-cyan-to-vivid-green-cyan)!important;}.has-luminous-vivid-amber-to-luminous-vivid-orange-gradient-background{background:var(--wp--preset--gradient--luminous-vivid-amber-to-luminous-vivid-orange)!important;}.has-luminous-vivid-orange-to-vivid-red-gradient-background{background:var(--wp--preset--gradient--luminous-vivid-orange-to-vivid-red)!important;}.has-very-light-gray-to-cyan-bluish-gray-gradient-background{background:var(--wp--preset--gradient--very-light-gray-to-cyan-bluish-gray)!important;}.has-cool-to-warm-spectrum-gradient-background{background:var(--wp--preset--gradient--cool-to-warm-spectrum)!important;}.has-blush-light-purple-gradient-background{background:var(--wp--preset--gradient--blush-light-purple)!important;}.has-blush-bordeaux-gradient-background{background:var(--wp--preset--gradient--blush-bordeaux)!important;}.has-luminous-dusk-gradient-background{background:var(--wp--preset--gradient--luminous-dusk)!important;}.has-pale-ocean-gradient-background{background:var(--wp--preset--gradient--pale-ocean)!important;}.has-electric-grass-gradient-background{background:var(--wp--preset--gradient--electric-grass)!important;}.has-midnight-gradient-background{background:var(--wp--preset--gradient--midnight)!important;}.has-small-font-size{font-size:var(--wp--preset--font-size--small)!important;}.has-medium-font-size{font-size:var(--wp--preset--font-size--medium)!important;}.has-large-font-size{font-size:var(--wp--preset--font-size--large)!important;}.has-x-large-font-size{font-size:var(--wp--preset--font-size--x-large)!important;}.wp-block-nigationa:where(:not(.wp-element-button)){color:inherit;}:where(.wp-block-post-template.is-layout-flex){gap:1.25em;}:where(.wp-block-post-template.is-layout-grid){gap:1.25em;}:where(.wp-block-columns.is-layout-flex){gap:2em;}:where(.wp-block-columns.is-layout-grid){gap:2em;}.wp-block-pullquote{font-size:1.5em;line-height:1.6;}@mediascreenand(min-width:1200px){.tg-container{max-width:1507px;}}button:hover,input[type="button"]:hover,input[type="reset"]:hover,input[type="submit"]:hover,#infinite-handlespan:hover{background-color:#1e7ba6;}.site-branding.site-title{font-size:2.313rem;}.widget{}/**/ window.dataLayer=window.dataLayer||[]; functiongt(){dataLayer.push(arguments);} gt('js',newDate()); gt('config','G-N2KSEQ7VS3'); window.wvt_global={"ajax":":\/\/unsia.ac.id\/wp-admin\/admin-ajax.php","wvt_url":":\/\/unsia.ac.id\/wp-content\/plugins\/wvt","placeholder":":\/\/unsia.ac.id\/wp-content\/plugins\/wvt\/assets\/img\/placeholder.jpg","load_scene":"ball-pulse","context":"Jegtheme","context_url":"http:\/\/jegtheme.com","edit":false,"lang":{"se":"SeOption","sing":"SingOption","sed":"Sed","spotlist":"Hotspot&TourList"}}; window.wvtf=[]; document.documentElement.className=document.documentElement.className.replace('no-js','js'); .no-jsimg.lazyload{display:none;} figure.wp-block-imeimg.lazyloading{min-width:150px;} .lazyload,.lazyloading{opacity:0;} .lazyloaded{ opacity:1; transition:opacity400ms; transition-delay:0ms; } .site-title, .site-description{ position:absolute; clip:rect(1px,1px,1px,1px); } functionsetREVStartSize(e){ //window.requestAnimationFrame(function(){ window.RSIW=window.RSIW===undefined?window.innerWidth:window.RSIW; window.RSIH=window.RSIH===undefined?window.innerHeight:window.RSIH; try{ varpw=document.getElementById(e.c).parentNode.offsetWidth, newh; pw=pw===0||isNaN(pw)?window.RSIW:pw; e.tabw=e.tabw===undefined?0:parseInt(e.tabw); e.thumbw=e.thumbw===undefined?0:parseInt(e.thumbw); e.tabh=e.tabh===undefined?0:parseInt(e.tabh); e.thumbh=e.thumbh===undefined?0:parseInt(e.thumbh); e.tabhide=e.tabhide===undefined?0:parseInt(e.tabhide); e.thumbhide=e.thumbhide===undefined?0:parseInt(e.thumbhide); e.mh=e.mh===undefined||e.mh==""||e.mh==="auto"?0:parseInt(e.mh,0); if(e.layout==="fullscreen"||e.l==="fullscreen") newh=Math.max(e.mh,window.RSIH); else{ e.gw=Array.isArray(e.gw)?e.gw:[e.gw]; for(variine.rl)if(e.gw[i]===undefined||e.gw[i]===0)e.gw[i]=e.gw[i-1]; e.gh=e.el===undefined||e.el===""||(Array.isArray(e.el)&&e.el.length==0)?e.gh:e.el; e.gh=Array.isArray(e.gh)?e.gh:[e.gh]; for(variine.rl)if(e.gh[i]===undefined||e.gh[i]===0)e.gh[i]=e.gh[i-1]; varnl=newArray(e.rl.length), ix=0, sl; e.tabw=e.tabhide>=pw?0:e.tabw; e.thumbw=e.thumbhide>=pw?0:e.thumbw; e.tabh=e.tabhide>=pw?0:e.tabh; e.thumbh=e.thumbhide>=pw?0:e.thumbh; for(variine.rl)nl[i]=e.rl[i]nl[i]&&nl[i]>0){sl=nl[i];ix=i;} varm=pw>(e.gw[ix]+e.tabw+e.thumbw)?1:(pw-(e.tabw+e.thumbw))/(e.gw[ix]); newh=(e.gh[ix]*m)+(e.tabh+e.thumbh); } varel=document.getElementById(e.c); if(el!==null&&el)el.style.height=newh+"px"; el=document.getElementById(e.c+"_wrapper"); if(el!==null&&el){ el.style.height=newh+"px"; el.style.display="block"; } }catch(e){ console.log("FailureatPresizeofSlider:"+e) } //}); }; UniversitasSiberAsia Menu VirtualTourTracerStudyBlogBeritaNewsletterKarirFAQ /*!elementor-v3.17.0-08-11-2023*/.elementor-widget-ime{text-align:center}.elementor-widget-imea{display:inline-block}.elementor-widget-imeaimg[src$=".svg"]{width:48px}.elementor-widget-imeimg{vertical-align:middle;display:inline-block} Menu BerandaTentang Profil LaporanRektor Sejarah VisidanMisi MaknaLogo StrukturOrganisasi RencanaStrategis Mars VirtualCampusTour FAQBiro BadanPenjaminanMutu LembaPenelitian038;PengabdianKepadaMasyarakat Profil Penelitian Pengabdian Pengaturan SIPPM JurnalUNSIA JMS JIS DigitalLibrary Informatika Manajemen SistemInformasi Komunikasi Akuntansi Kerjasama SumberDayaManusia Karir LayananBSDM KeuanganAkademik ProgramStudi Sarjana PJJSistemInformasi PJJInformatika PJJManajemen PJJAkuntansi PJJKomunikasi Mister(Segeradibuka) MetodePembelajaran Akreditasi Dosen KalenderAkademik KampusMerdeka PanduanPembelajaranOnline SistemPembelajaranOnline SistemInformasiAkademik DigitalLibrary TrackProgram VirtualLab DistribusiMahasiswa DirektoriBAAKemahasiswaan Beasiswa PrestasiMahasiswa E-KonselingPendaftaran AlurPendaftaran SyaratPendaftaran PendaftaranMahasiswaBaru BiayaKuliah RekananPendaftaran JalurKonversiFasilitasKontak Pendaftaran Menu BerandaTentang Profil LaporanRektor Sejarah VisidanMisi MaknaLogo StrukturOrganisasi RencanaStrategis Mars VirtualCampusTour FAQBiro BadanPenjaminanMutu LembaPenelitian038;PengabdianKepadaMasyarakat Profil Penelitian Pengabdian Pengaturan SIPPM JurnalUNSIA JMS JIS DigitalLibrary Informatika Manajemen SistemInformasi Komunikasi Akuntansi Kerjasama SumberDayaManusia Karir LayananBSDM KeuanganAkademik ProgramStudi Sarjana PJJSistemInformasi PJJInformatika PJJManajemen PJJAkuntansi PJJKomunikasi Mister(Segeradibuka) MetodePembelajaran Akreditasi Dosen KalenderAkademik KampusMerdeka PanduanPembelajaranOnline SistemPembelajaranOnline SistemInformasiAkademik DigitalLibrary TrackProgram VirtualLab DistribusiMahasiswa DirektoriBAAKemahasiswaan Beasiswa PrestasiMahasiswa E-KonselingPendaftaran AlurPendaftaran SyaratPendaftaran PendaftaranMahasiswaBaru BiayaKuliah RekananPendaftaran JalurKonversiFasilitasKontak Pendaftaran Menu BerandaTentang Profil LaporanRektor Sejarah VisidanMisi MaknaLogo StrukturOrganisasi RencanaStrategis Mars VirtualCampusTour FAQBiro BadanPenjaminanMutu LembaPenelitian038;PengabdianKepadaMasyarakat Profil Penelitian Pengabdian Pengaturan SIPPM JurnalUNSIA JMS JIS DigitalLibrary Informatika Manajemen SistemInformasi Komunikasi Akuntansi Kerjasama SumberDayaManusia Karir LayananBSDM KeuanganAkademik ProgramStudi Sarjana PJJSistemInformasi PJJInformatika PJJManajemen PJJAkuntansi PJJKomunikasi Mister(Segeradibuka) MetodePembelajaran Akreditasi Dosen KalenderAkademik KampusMerdeka PanduanPembelajaranOnline SistemPembelajaranOnline SistemInformasiAkademik DigitalLibrary TrackProgram VirtualLab DistribusiMahasiswa DirektoriBAAKemahasiswaan Beasiswa PrestasiMahasiswa E-KonselingPendaftaran AlurPendaftaran SyaratPendaftaran PendaftaranMahasiswaBaru BiayaKuliah RekananPendaftaran JalurKonversiFasilitasKontak InformasiPendaftaranSayembaraLogoAyo,tunjukkankreativitasmu,raihhadiahdanmenjadibiadalamsejarahUniversitasSiberAsiadenganberpartisipasidalamSayembaraDesainLogoUniversitasSiberAsia. Selengkapnya KampusFull-OnlinePERTAMAdiIndonesiaterakreditasiBAN-PTdanRekognisiInternasionaldariEAHEA SKMenteriNomor757/M/2020izinPendirianUniversitasSiberAsia24ustus2020. DaftarSekarang DownloadBROSUR setREVStartSize({c:'rev_slider_1_1',rl:[1240,1024,778,480],el:[600,500,400,250],gw:[1325,1140,768,480],gh:[600,500,400,200],type:'standard',justify:'',layout:'fullwidth',mh:"400"});if(window.RS_MODULES!==undefined&&window.RS_MODULES.modules!==undefined&&window.RS_MODULES.modules["revslider11"]!==undefined){window.RS_MODULES.modules["revslider11"].once=false;window.revapi1=undefined;if(window.RS_MODULES.checkMUniversitas Siber Asiainimal!==undefined)window.RS_MODULES.checkMinimal()} /*!elementor-v3.17.0-08-11-2023*/.elementor-heading-title{padding:0;margin:0;line-height:1}.elementor-widget-heading.elementor-heading-title[class*=elementor-size-]>a{color:inherit;font-size:inherit;line-height:inherit}.elementor-widget-heading.elementor-heading-title.elementor-size-small{font-size:15px}.elementor-widget-heading.elementor-heading-title.elementor-size-medium{font-size:19px}.elementor-widget-heading.elementor-heading-title.elementor-size-large{font-size:29px}.elementor-widget-heading.elementor-heading-title.elementor-size-xl{font-size:39px}.elementor-widget-heading.elementor-heading-title.elementor-size-xxl{font-size:59px}UniversitasSiberAsia UniversitasFullOnline /*!elementor-v3.17.0-08-11-2023*/.elementor-widget-text-editor.elementor-drop-cap-view-stacked.elementor-drop-cap{background-color:#d;color:#fff}.elementor-widget-text-editor.elementor-drop-cap-view-framed.elementor-drop-cap{color:#d;border:3pxsolid;background-color:transparent}.elementor-widget-text-editor:not(.elementor-drop-cap-view-default).elementor-drop-cap{margin-top:8px}.elementor-widget-text-editor:not(.elementor-drop-cap-view-default).elementor-drop-cap-letter{width:1em;height:1em}.elementor-widget-text-editor.elementor-drop-cap{float:left;text-align:center;line-height:1;font-size:50px}.elementor-widget-text-editor.elementor-drop-cap-letter{display:inline-block} Cyberuniversity atauuniversitassiberadalahmerupakanrevolusipengembanganperguruantinggiyangberbasispadakonsepsoft-universitysystemmelibatkanplatformsmartdigitaltechnologybaiksecarahardwaremaupunsecarasoftwareyangbertujuanuntukmeningkatkankeahlianmahasiswadalammenguasaipilar-pilarpengembanganteknologiinformasiyakniArtificialIntelligence,MachineLearning,DigitalTwin,BigData,DataScience,danQuantumComputing. Selengkapnya /*!elementor-v3.17.0-08-11-2023*/.elementor-column.elementor-spacer-inner{height:var(--spacer-size)}.e-con{--container-widget-width:100%}.e-con-inner>.elementor-widget-spacer,.e-con>.elementor-widget-spacer{width:var(--container-widget-width,var(--spacer-size));--align-self:var(--container-widget-align-self,initial);--flex-shrink:0}.e-con-inner>.elementor-widget-spacer>.elementor-widget-container,.e-con>.elementor-widget-spacer>.elementor-widget-container{height:100%;width:100%}.e-con-inner>.elementor-widget-spacer>.elementor-widget-container>.elementor-spacer,.e-con>.elementor-widget-spacer>.elementor-widget-container>.elementor-spacer{height:100%}.e-con-inner>.elementor-widget-spacer>.elementor-widget-container>.elementor-spacer>.elementor-spacer-inner,.e-con>.elementor-widget-spacer>.elementor-widget-container>.elementor-spacer>.elementor-spacer-inner{height:var(--container-widget-height,var(--spacer-size))}.e-con-inner>.elementor-widget-spacer.elementor-widget-empty,.e-con>.elementor-widget-spacer.elementor-widget-empty{position:relative;min-height:22px;min-width:22px}.e-con-inner>.elementor-widget-spacer.elementor-widget-empty.elementor-widget-empty-icon,.e-con>.elementor-widget-spacer.elementor-widget-empty.elementor-widget-empty-icon{position:absolute;top:0;bottom:0;left:0;right:0;margin:auto;padding:0;width:22px;height:22px} LayananUniversitasSiberAsia LMS LearningManementSystemyangdigunakandalampembelajaranUNSIA. SIAKAD LearningManementSystemyangdigunakandalampembelajaranUNSIA. LIBRARY LearningManementSystemyangdigunakandalampembelajaranUNSIA. EConselling LearningManementSystemyangdigunakandalampembelajaranUNSIA. OJS LearningManementSystemyangdigunakandalampembelajaranUNSIA. WebDosen LearningManementSystemyangdigunakandalampembelajaranUNSIA. SIPPM LearningManementSystemyangdigunakandalampembelajaranUNSIA. Kal.Akademik LearningManementSystemyangdigunakandalampembelajaranUNSIA. Pendaftaran LearningManementSystemyangdigunakandalampembelajaranUNSIA. LMS LayananPembelajaranOnlinedenganteknologiterkini SIAKAD LayananPerkuliahandenganTeknologiMultiplatform DigitalLibrary Layananperpustakaandigitaldengankoleksiribuanebook e-counseling LayanankonsultasiOnlinedenganPsikolog OJS LayananpublikasijurnalpenelitiandanjurnalPKM WebDosen Layananinformasiaktifitastridharmadosen SIPPM LayananInformasiPenelitandanPengabdianMasyarakat Kal.Akademik Layananinformasikalenderakademiksetiapsemester ProgramStudi UniversitasSiberAsia ManajemenPJJS1ProdiManajemendidirikanuntukmenjawabtantanganrevolusiindustry4,0dimanasemuaoperasiperusahaansaatinibekerjaatasdasarteknologiinformasidigital.ManajemendiharapkanakanmenghasilkanlulusanyangbermutudibidangmanajemenuntukdapatSelengkapnyaAkuntansiPJJS1ProgramStudiAkuntansimerupakandisiplinilmuyangberhubungandenganakuntansigunamenyelesaikanmasalah-masalahperhitunganakuntansidalamperusahaan.LulusanAkuntansimempunyaikesempatankarirdibidangperbankanmaupunperusahaan.SelengkapnyaSisteminformasiPJJS1ProdiSistemInformasimerupakandisiplinilmuyangberhubungandenganteknologiinformasidankomunikasigunamenyelesaikanmasalah,yaitumasalahbisnisdanteknologidalamperusahaan.Lulusansisteminformasimempunyaikesempatankarirdibidangbisnisdanteknologiinformasi.SelengkapnyaInformatikaPJJS1ProgramStudiInformatikadidirikanuntukmenjawabtantanganrevolusiindustri4,0dimanasemuaoperasiperusahaansaatinibekerjaatasdasarteknologiinformasidigital.InformatikadiharapkanakanmenghasilkanlulusanyangbermutudibidangInformatikauntukdapatdiserapolehstakeholder/user.SelengkapnyaKomunikasiPJJS1ProgramstudiKomunikasididirikanuntukmenjawabtantanganrevolusiindustry4,0dimanasemuaoperasiperusahaansaatinibekerjaatasdasarkomunikasidigital.KomunikasidiharapkanakanmenghasilkanlulusanyangbermutudibidangKomunikasiuntukdapatdiserapolehstakeholder/user.Selengkapnya MetodePembelajaran UniversitasSiberAsia SinkronSinkronadalahpembelajaranyangdilakukansecararealtimeyaitudimanapembelajaranyangdilakukanantaradosendenganmahasiswasama-samaonlinedandapatmelakukankominikasiduaarahsecaralangsungmemberikanfeedbackSelengkapnya AsinkronAsinkronadalahpembelajaranyangdilakukansecaratunda,maksudnyapembelajaranyangtidakharussama-samaonlineakantetapidilakukandenganLMS,dimanamaterisudahdipersiapkandosensupayadapatdiaksesolehmahasiswasecarafleksibelyangdapatdilakukankapansajadandimanasaja.Selengkapnya ProgramTeachingProfessor ProgramTeachingProfessormerupakaninisiatifutamadariUniversitasSiberAsiayangbertujuanuntukmeningkatkankualitaspendidikandanpengajaran.Melaluiprogramini,fakultasdantenapengajardiberikanpeluanguntukmengembangkanketerampilanmengajaryanginovatifdanefektif,sertaberbipraktikterbaikdalampendidikan.Tujuanutamanyaadalahmenciptakanlingkunganpembelajaranyanginspiratifdanmendukungperkembanganakademikparamahasiswa. /*!elementor-v3.17.0-08-11-2023*/.elementor-widget-video.elementor-widget-container{overflow:hidden;transform:translateZ(0)}.elementor-widget-video.elementor-wrapper{aspect-ratio:var(--video-aspect-ratio)}.elementor-widget-video.elementor-wrapperiframe,.elementor-widget-video.elementor-wrappervideo{height:100%;width:100%;display:flex;border:none;background-color:#000}@supportsnot(aspect-ratio:1/1){.elementor-widget-video.elementor-wrapper{position:relative;overflow:hidden;height:0;padding-bottom:calc(100%/var(--video-aspect-ratio))}.elementor-widget-video.elementor-wrapperiframe,.elementor-widget-video.elementor-wrappervideo{position:absolute;top:0;right:0;bottom:0;left:0}}.elementor-widget-video.elementor-open-inline.elementor-custom-embed-ime-overlay{position:absolute;top:0;right:0;bottom:0;left:0;background-size:cover;background-position:50%}.elementor-widget-video.elementor-custom-embed-ime-overlay{cursor:pointer;text-align:center}.elementor-widget-video.elementor-custom-embed-ime-overlay:hover.elementor-custom-embed-playi{opacity:1}.elementor-widget-video.elementor-custom-embed-ime-overlayimg{display:block;width:100%;aspect-ratio:var(--video-aspect-ratio);-o-object-fit:cover;object-fit:cover;-o-object-position:centercenter;object-position:centercenter}@supportsnot(aspect-ratio:1/1){.elementor-widget-video.elementor-custom-embed-ime-overlay{position:relative;overflow:hidden;height:0;padding-bottom:calc(100%/var(--video-aspect-ratio))}.elementor-widget-video.elementor-custom-embed-ime-overlayimg{position:absolute;top:0;right:0;bottom:0;left:0}}.elementor-widget-video.e-hosted-video.elementor-video{-o-object-fit:cover;object-fit:cover}.e-con-inner>.elementor-widget-video,.e-con>.elementor-widget-video{width:var(--container-widget-width);--flex-grow:var(--container-widget-flex-grow)} PlayVideo ManajemenPJJS1 Selengkapnya PlayVideo AkuntansiPJJS1 Selengkapnya PlayVideo SistemInformasiPJJS1 Selengkapnya PlayVideo InformatikaPJJS1 Selengkapnya PlayVideo KomunikasiPJJS1 Selengkapnya EventUniversitasSiberAsia Temukanberbaieventyangdapatandaikuti,sertadapatkansertifikatnya IkutiEvent Terakreditasi NasionaldanInternasional UniversitasSiberAsia(UNSIA)telahsuksesmeraihakreditasidariBadanAkreditasiNasionalPerguruanTinggi(BAN-PT)ditingkatnasionaldanEuropeanencyforHigherEducationandAccreditation(EAHEA)ditingkatinternasional.KeberhasilaninimencerminkankomitmenUNSIAterhadapstandarkualitaspendidikantinggi,baikdalamlingkupnasionalmaupuninternasional.Denganprestasiini,UNSIAmenawarkanpengalamanbelajarterbaik,menegaskanreputasinyasebailembapendidikantinggiyangungguldanberorientasiglobal. /*!elementor-v3.17.0-08-11-2023*/.elementor-widget-divider{--divider-border-style:none;--divider-border-width:1px;--divider-color:#0c0d0e;--divider-icon-size:20px;--divider-element-spacing:10px;--divider-pattern-height:24px;--divider-pattern-size:20px;--divider-pattern-url:none;--divider-pattern-repeat:repeat-x}.elementor-widget-divider.elementor-divider{display:flex}.elementor-widget-divider.elementor-divider__text{font-size:15px;line-height:1;max-width:95%}.elementor-widget-divider.elementor-divider__element{margin:0var(--divider-element-spacing);flex-shrink:0}.elementor-widget-divider.elementor-icon{font-size:var(--divider-icon-size)}.elementor-widget-divider.elementor-divider-separator{display:flex;margin:0;direction:ltr}.elementor-widget-divider--view-line_icon.elementor-divider-separator,.elementor-widget-divider--view-line_text.elementor-divider-separator{align-items:center}.elementor-widget-divider--view-line_icon.elementor-divider-separator:after,.elementor-widget-divider--view-line_icon.elementor-divider-separator:before,.elementor-widget-divider--view-line_text.elementor-divider-separator:after,.elementor-widget-divider--view-line_text.elementor-divider-separator:before{display:block;content:"";border-bottom:0;flex-grow:1;border-top:var(--divider-border-width)var(--divider-border-style)var(--divider-color)}.elementor-widget-divider--element-align-left.elementor-divider.elementor-divider-separator>.elementor-divider__svg:first-of-type{flex-grow:0;flex-shrink:100}.elementor-widget-divider--element-align-left.elementor-divider-separator:before{content:none}.elementor-widget-divider--element-align-left.elementor-divider__element{margin-left:0}.elementor-widget-divider--element-align-right.elementor-divider.elementor-divider-separator>.elementor-divider__svg:last-of-type{flex-grow:0;flex-shrink:100}.elementor-widget-divider--element-align-right.elementor-divider-separator:after{content:none}.elementor-widget-divider--element-align-right.elementor-divider__element{margin-right:0}.elementor-widget-divider:not(.elementor-widget-divider--view-line_text):not(.elementor-widget-divider--view-line_icon).elementor-divider-separator{border-top:var(--divider-border-width)var(--divider-border-style)var(--divider-color)}.elementor-widget-divider--separator-type-pattern{--divider-border-style:none}.elementor-widget-divider--separator-type-pattern.elementor-widget-divider--view-line.elementor-divider-separator,.elementor-widget-divider--separator-type-pattern:not(.elementor-widget-divider--view-line).elementor-divider-separator:after,.elementor-widget-divider--separator-type-pattern:not(.elementor-widget-divider--view-line).elementor-divider-separator:before,.elementor-widget-divider--separator-type-pattern:not([class*=elementor-widget-divider--view]).elementor-divider-separator{width:100%;min-height:var(--divider-pattern-height);-webkit-mask-size:var(--divider-pattern-size)100%;mask-size:var(--divider-pattern-size)100%;-webkit-mask-repeat:var(--divider-pattern-repeat);mask-repeat:var(--divider-pattern-repeat);background-color:var(--divider-color);-webkit-mask-ime:var(--divider-pattern-url);mask-ime:var(--divider-pattern-url)}.elementor-widget-divider--no-spacing{--divider-pattern-size:auto}.elementor-widget-divider--bg-round{--divider-pattern-repeat:round}.rtl.elementor-widget-divider.elementor-divider__text{direction:rtl}.e-con-inner>.elementor-widget-divider,.e-con>.elementor-widget-divider{width:var(--container-widget-width,100%);--flex-grow:var(--container-widget-flex-grow)} Berita SambutanhangatkepadapembacasetiaUniversitasSiberAsia!Kamidenganbanggamenghadirkanberitaterbaru,inovasi,danprestasidariseluruhcivitasUNSIA.Melaluiberitaini,kamiberupayauntukmemberikanpandanganmendalamtentangperkembanganterkinidibidangpendidikan,penelitian,danberbaiaspeklainyangmemengaruhiduniaakademik.Dengantekadkuatuntukmemajukanpendidikandanberbiinformasiberharga,kamiharapberitakamiakanmenjadisumberinspirasidanpengetahuanbipembaca.MarikitaterusmengikutiperkembanganberitadariUniversitasSiberAsia! TigaProdiUNSIATerakreditasiInternasional October1,2023 EAHEA(EuropeanencyforHigherEducation&Accreditation)MemberikanSeriftikatAkreditasikepadatigaprodidiUNSIAyakniProdiAkutansi,Manajemen… Selengkapnya DosenTerbaikUNSIAGenap2022/2023 October1,2023 RatihAnggoroWilis,S.E.,M.M.DosentetapProdiManajementerpilihsebaiDosenTerbaikSemesterGenap2022/2023.Penyerahansertifikatdanhadiahdi… Selengkapnya UNSIAComing2U September15,2023 KegiatanUNSIAComing2UadalahkegiatankemahasiswaanyangdiprakarsaiolehBiroKemahasiswaan,KerjasamaInternasional&Tridarmauntukmendekatkandirikepada… Selengkapnya ProgramTeachingProfessor TATACARAPEMBAYARANDAFTARULANGJALURREGULERLoginmenggunakanIDdanPINPendaftarandiwebadmission.unsia.ac.idklikMenuriwayatkeuangankemudian...ReadMoreKeuanganUniversitasAugust3,2023LembaPenelitiandanPengabdianMasyarakat(LPPM)UniversitasSiberUniversitasSiberAsia,sebaisalahsatuinstitusipendidikantinggiyangberfokuspadateknologiinformasidan...ReadMoreLPPMUniversitasSiberAsiaAugust3,2023BadanPenjaminanMutuUniversitas:MenjaKualitasPendidikanTinggiPendidikantinggimemegangperanpentingdalammempersiapkangenerasipenerusuntukmasadepanyanglebihbaik....ReadMoreadminAugust3,2023LoadMore PrestasiMahasiswa PrestasimahasiswaUniversitasSiberAsiamerupakancerminandaridedikasidankomitmentinggiyangdimilikiolehparamahasiswadilingkunganakademikdannonakademikyanginovatif.Melaluikerjakeras,penelitianberkualitas,danpartisipasiaktifdalamberbaikegiatanakademikdannonakademik,mahasiswaUniversitasSiberAsiatelahmeraihprestasiyangmembanggakan,yangakankamibahasdalaminformasiberikutini. PertukaranPemudaAsiaChapter4 PertukaranPemudaAsiaChapter4PartisipasiVeraSriHandayanidalamPertukaranPemudaAsiakeTurkiadalahsuatupengalamanyangsangat… Selengkapnya AccountingDebateCompetition AccountingDebateCompetitionPenghargaanyangditerimaolehVeraHandayanikarenamengikutiLombaAccountingDebateadalahpencapaianyangpatutdibanggakan.Ini… Selengkapnya LombaVideoPembelajaranKegiatanGemaMatematika… LombaVideoPembelajaranKegiatanGemaMatematikaXXIPenghargaanyangditerimaolehVeraHandayanisebaiJuara3dalamLombaVideoPembelajaran… Selengkapnya BlogUNSIA BlogUniversitasSiberAsia,merupakantempatdimanaAndaakanmenemukanwawasanmendalam,pengetahuanterbaru,daninspirasidariberbgairangkaianartikeldanpublikasiberkualitaskami,bloginibertujuanuntukmembikanpandanganterkinimengenaipendidikan,inovasi,sertatantanganglobalyangsedangdihadapi.Marimenjelajahidanberbipengetahuanbersamadiduniadigitalyangterusberkembangini. TanamPohon,JaBumi HariMenanamPohonNasionaldiperingatisetiaptanggal28NovemberdiIndonesia.Peringataninibertujuanuntukmeningkatkankesadaranmasyarakatakanpentingnya… Selengkapnya TantanganLaki-lakidalamKesehatanMental,Pendidikan,… Dalamkehidupansosial,peranlaki-lakiseringkalidikaitkandengantanggungjawab,kekuatan,danketahanan.Namun,pandanganiniseringkalimenutupitantangan… Selengkapnya SURATUNTUKPAPA *Disclaimer:mengandungbawangTeruntukpahlawanhidupku,ksatriasejatiyangmenemanidarimasakecilkuhinggasekarang,terimakasih.Papa,Akumenulis… Selengkapnya Testimoni Prof.Dr.(H.C.)K.H.Ma8217;rufAminWakilPresidenRI8220;SebaiNegarakepulauandengankondisisosialekonomiberam,Pendidikanmelaluisistempembelajarandaring/e-learningmenjadisebuahpilihanmasyarakatuntukmengaksespendidikantinggiberkualitas8221;.Prof.Dr.(H.C.)K.H.Ma'rufAminWakilPresidenRIFirmanAlamsyah8211;MahasiswaProdiKomunikasiPJJS1SayaBersyukurMemilihKuliahProdiKomunikasiUNSIA,SayaMerasakanManfaatnyaMempelajariIlmuKomunikasiBukanHanyaTeoriTetapiJugaPraktekBerkomunikasiYangEfektifKhususnyaAdalahKeterampilanPublicSpeaking.FirmanAlamsyahMahasiswaProdiKomunikasiPJJS1AbdulAziz(ProgramStudiAkuntansi)8220;SabisamenaikutiperkuliahandiUNSIAdalamhalwaktustudidanperkuliahanyangbaik,kerjasamadenganteman-temansayajugabaik8221;.AbdulAziz(ProgramStudiAkuntansi)AnnaNurRahmaAssyifa(ProgramStudiInformatika)8220;Pembelajaranonlinesangatmembantusayaterutamadimasapandemiini8221;.AnnaNurRahmaAssyifaLutfiIndraYuda(ProgramStudiSistemInformasi)8220;SayasangatterbantudenganadanyaUNSIA,karenamelaluiUNSIAsayabisamelanjutkanpassionsayadibidangIT,asalkanmendapatkanmateripembelajaranyanglebihbanyaksambil/belajardiprogramvokasi8221;.LutfiIndraYudaRidhoIrawan8211;ChiefMarketingOfficer(CMO)SEVIMASebentarlaqiUniversitasSiberAsiaakanmerayakanUlangtahunyangke-2.SayaRidhoIrawandansegenapSevimamengucapkandirgahayuUnsiayangke-2.SemogaUnsiasebaikampusDigitalterusmeningkatkanaksesmasvarakatindonesiauntukmengenyampendidikantinggidalamrangkamewujudkanvisipemerintahSDMunggulIndonesiamaju.SemogaUnsiadapatmenyediakanaksesyanglebihluasbimasyarakatuntukdapatmenikmatipendidikantinggi.DirgahayuUnsia.RidhoIrawanDr.Ir.ParistiyantiNurwardani,M.P8211;KepalaLLDIKTIWilayah8220;PotensimasadepanyangditawarkanolehlimaPordidiUNSIA,biBapak/lbuterutamateman-temanatauadik-adikyangakanbergabungdenganUNSIAjangankhawatirsayamengawaldarisejakUsia2tahunsebelumberdiri,sampaidenganhariinivangsedangmengurusAkreditasi,jadisayaberikanpenjaminanmutusebaikepalaLLDIKTIwilayahDKIJakartabahwauniversitasyangmemangmengedepankanberbaimacamteknologivanqsebenarnyabeberapaperguruantinggidiIndonesiabelumpunya.8221;Dr.Ir.ParistiyantiNurwardani,M.P-KepalaLLDIKTIWilayahM.Raihan8211;DirekturHeroleads8220;MenurutkamisetelahbekeriasamadenganUNSIAyangkamirasakanadalahkum,karenawalaupundiusianyamasihsangatmudaunsiamemilikivisiyangsangatjelaskemudianjugasecaratimsecarakapabilitassudahdipersiapkandenganbaikdengandukungandarikoreaselatantentunya,inimenjadiharapanbarubimasyarakatindonesiauntukmeningkatkanAPKdiduniapendidikandanunsiasejauhinimenunjukanpositioningnyadenganbaik.8221;M.Raihan-DirekturHeroleadsPujiAstutik(ProdiKomunikasiS1PJJ)8220;SayabanggajadimahasiswadiUNSIAkarenapelayanandansistembelajaryangsangatfleksibelterutamabipekerjasepertisaya.Ilmuyangkomprehensifdidukungsistemonline,dosenyangkompeten,temandariberbaidaerahdanbiayakuliahyangterjangkaumerupakansayasenangkuliahdiUNSIA8221;PujiAstutik(ProdiKomunikasiS1PJJ)M.SyaifulAnwar(ProgramStudiManajemen)8220;Sayamerasamelaluipembelajaranjarakjauhatauyangkitakenaldenganpembelajaranonlinesangatmembantubisaya,berkepribadiandanberpikiryangsangatfleksibeldandapatdiandalkandanjugaterutamabimerekayangtelahbekerjadanmemilikiniatuntukmendapatkangelardariuniversitasuntukmenunjangkarirdanjabatankita8217;.M.SyaifulAnwar(ProgramStudiManajemen) KerjasamaUNSIA /*!elementor-v3.17.0-08-11-2023*/.elementor-widget-ime-carousel.swiper,.elementor-widget-ime-carousel.swiper-container{position:static}.elementor-widget-ime-carousel.swiper-container.swiper-slidefigure,.elementor-widget-ime-carousel.swiper.swiper-slidefigure{line-height:inherit}.elementor-widget-ime-carousel.swiper-slide{text-align:center}.elementor-ime-carousel-wrapper:not(.swiper-container-initialized):not(.swiper-initialized).swiper-slide{max-width:calc(100%/var(--e-ime-carousel-slides-to-show,3))} TungguApaLi? MaribergabungbersamakeluargabesarUniversitasSiberAsia,dimanapun,kapaunpunbisaKuliah DownloadBrosur DAFTARSEKARANG MerupakanuniversitaspertamadiIndonesiayangberbasisfullonlinelearning dibawahYayasanMemajukanIlmuDanKebudayaan(YMIK)Selengkapnya HubungiKami Jl.HarsonoRM,Runan,PasarMingguJakartaSelatan (021)278-061-89 admission@unsia.ac.id Layanan SistemInformasiAkademik WebEvent JurnalIlmuSiber DigitalLibrary SistemPembelajaranOnline PendaftaranMahasiswaBaru Universitas Siber Asia Universitas Siber Asia ProgramStudi ManajemenPJJS1 InformatikaPJJS1 SistemInformasiPJJS1 AkuntansiPJJS1 KomunikasiPJJS1 Langganan DapatkaninformasiterkdiridariUniversitasSiberAsia Galeri /*!elementor-v3.17.0-08-11-2023*/.elementor-ime-gallery.gallery-item{display:inline-block;text-align:center;vertical-align:top;width:100%;max-width:100%;margin:0auto}.elementor-ime-gallery.gallery-itemimg{margin:0auto}.elementor-ime-gallery.gallery-item.gallery-caption{margin:0}.elementor-ime-galleryfigureimg{display:block}.elementor-ime-galleryfigurefigcaption{width:100%}.gallery-spacing-custom.elementor-ime-gallery.gallery-icon{padding:0}@media(min-width:768px){.elementor-ime-gallery.gallery-columns-2.gallery-item{max-width:50%}.elementor-ime-gallery.gallery-columns-3.gallery-item{max-width:33.33%}.elementor-ime-gallery.gallery-columns-4.gallery-item{max-width:25%}.elementor-ime-gallery.gallery-columns-5.gallery-item{max-width:20%}.elementor-ime-gallery.gallery-columns-6.gallery-item{max-width:16.666%}.elementor-ime-gallery.gallery-columns-7.gallery-item{max-width:14.28%}.elementor-ime-gallery.gallery-columns-8.gallery-item{max-width:12.5%}.elementor-ime-gallery.gallery-columns-9.gallery-item{max-width:11.11%}.elementor-ime-gallery.gallery-columns-10.gallery-item{max-width:10%}}@media(min-width:480px)and(max-width:767px){.elementor-ime-gallery.gallery.gallery-columns-2.gallery-item,.elementor-ime-gallery.gallery.gallery-columns-3.gallery-item,.elementor-ime-gallery.gallery.gallery-columns-4.gallery-item,.elementor-ime-gallery.gallery.gallery-columns-5.gallery-item,.elementor-ime-gallery.gallery.gallery-columns-6.gallery-item,.elementor-ime-gallery.gallery.gallery-columns-7.gallery-item,.elementor-ime-gallery.gallery.gallery-columns-8.gallery-item,.elementor-ime-gallery.gallery.gallery-columns-9.gallery-item,.elementor-ime-gallery.gallery.gallery-columns-10.gallery-item{max-width:50%}}@media(max-width:479px){.elementor-ime-gallery.gallery.gallery-columns-2.gallery-item,.elementor-ime-gallery.gallery.gallery-columns-3.gallery-item,.elementor-ime-gallery.gallery.gallery-columns-4.gallery-item,.elementor-ime-gallery.gallery.gallery-columns-5.gallery-item,.elementor-ime-gallery.gallery.gallery-columns-6.gallery-item,.elementor-ime-gallery.gallery.gallery-columns-7.gallery-item,.elementor-ime-gallery.gallery.gallery-columns-8.gallery-item,.elementor-ime-gallery.gallery.gallery-columns-9.gallery-item,.elementor-ime-gallery.gallery.gallery-columns-10.gallery-item{max-width:100%}} ©2023UniversitasSiberAsia|PoweredbyBPPTIUniversitasSiberAsia YayasanMemajukanIlmudanKebudayaan window.RS_MODULES=window.RS_MODULES||{}; window.RS_MODULES.modules=window.RS_MODULES.modules||{}; window.RS_MODULES.waiting=window.RS_MODULES.waiting||[]; window.RS_MODULES.defered=true; window.RS_MODULES.moduleWaiting=window.RS_MODULES.moduleWaiting||{}; window.RS_MODULES.type='compiled'; varsbiajaxurl="unsia.ac.id/wp-admin/admin-ajax.php"; if(typeofrevslider_showDoubleJqueryError==="undefined"){functionrevslider_showDoubleJqueryError(sliderID){console.log("Youhesomejquery.jslibraryincludethatcomesaftertheSliderRevolutionfilesjsinclusion.");console.log("Tofixthis,youcan:");console.log("1.Set'ModuleGeneralOptions'->'Advanced'->'jQuery&OutPutFilters'->'PutJStoBody'toon");console.log("2.FindthedoublejQuery.jsinclusionandremoveit");return"DoubleIncludedjQueryLibrary";}}#rs-demo-id{}/**//**//**//**//**//**//**//**//**//**//**//**/ var tpj=jQuery; var revapi1; if(window.RS_MODULES===undefined)window.RS_MODULES={}; if(RS_MODULES.modules===undefined)RS_MODULES.modules={}; RS_MODULES.modules["revslider11"]={once:RS_MODULES.modules["revslider11"]!==undefined?RS_MODULES.modules["revslider11"].once:undefined,init:function(){ window.revapi1=window.revapi1===undefined||window.revapi1===null||window.revapi1.length===0?document.getElementById("rev_slider_1_1"):window.revapi1; if(window.revapi1===null||window.revapi1===undefined||window.revapi1.length==0){window.revapi1initTry=window.revapi1initTry===undefined?0:window.revapi1initTry+1;if(window.revapi1initTry

Tapak:Universitas Siber AsiaLapor

Sekiranya terdapat pelanggaran laman web ini, silakan klik LaporkanLapor

Maklumat yang disyorkan

Laman web yang disyorkan